alpha Lactalbumin (LALBA) (NM_002289) Human Recombinant Protein

Lactalbumin Alpha protein,

Recombinant protein of human lactalbumin, alpha- (LALBA)

Product Info Summary

SKU: PROTP00709
Size: 20 µg
Source: HEK293T

Product Name

alpha Lactalbumin (LALBA) (NM_002289) Human Recombinant Protein

View all Lactalbumin Alpha recombinant proteins

SKU/Catalog Number

PROTP00709

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human lactalbumin, alpha- (LALBA)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

alpha Lactalbumin (LALBA) (NM_002289) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP00709)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

14 kDa

Amino Acid Sequence

MRFFVPLFLVGILFPAILAKQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKL

Validation Images & Assay Conditions

Gene/Protein Information For LALBA (Source: Uniprot.org, NCBI)

Gene Name

LALBA

Full Name

Alpha-lactalbumin

Weight

14 kDa

Superfamily

glycosyl hydrolase 22 family

Alternative Names

alpha-lactalbumin; lactalbumin, alpha-; Lactose synthase B protein; Lysozyme-like protein 7; LYZL7; MGC138521; MGC138523 LALBA LYZG lactalbumin alpha alpha-lactalbumin|lactose synthase B protein|lysozyme G|lysozyme-like protein 7

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on LALBA, check out the LALBA Infographic

LALBA infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for LALBA: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP00709

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used alpha Lactalbumin (LALBA) (NM_002289) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For alpha Lactalbumin (LALBA) (NM_002289) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for alpha Lactalbumin (LALBA) (NM_002289) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP00709
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.