AHSA2 (NM_152392) Human Recombinant Protein

AHSA2P protein,

Recombinant protein of human AHA1, activator of heat shock 90kDa protein ATPase homolog 2 (yeast) (AHSA2)

Product Info Summary

SKU: PROTQ719I0
Size: 20 µg
Source: HEK293T

Product Name

AHSA2 (NM_152392) Human Recombinant Protein

View all AHSA2P recombinant proteins

SKU/Catalog Number

PROTQ719I0

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human AHA1, activator of heat shock 90kDa protein ATPase homolog 2 (yeast) (AHSA2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

AHSA2 (NM_152392) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ719I0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

15.5 kDa

Amino Acid Sequence

MILPTKAMATQELTVKRKLSGNTLQVQASSPVALGVRIPTVALHMMELFDTTVEQLYSIFTVKELTNKKIIMKWRCGNWPEEHYAMVALNFVPTLGQTELQLKEFLSICKEENMKFCWQKQHFEEIKGSLQLTPLNG

Validation Images & Assay Conditions

Gene/Protein Information For AHSA2P (Source: Uniprot.org, NCBI)

Gene Name

AHSA2P

Full Name

Putative activator of 90 kDa heat shock protein ATPase homolog 2

Weight

15.5 kDa

Superfamily

AHA1 family

Alternative Names

Putative activator of 90 kDa heat shock protein ATPase homolog 2 AHSA2P AHA1, AHSA2, Hch1 activator of HSP90 ATPase homolog 2, pseudogene AHA1, activator of heat shock 90kDa protein ATPase homolog 2|activator of 90 kDa heat shock protein ATPase homolog 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on AHSA2P, check out the AHSA2P Infographic

AHSA2P infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for AHSA2P: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ719I0

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used AHSA2 (NM_152392) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For AHSA2 (NM_152392) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for AHSA2 (NM_152392) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ719I0
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.