ACN9 (SDHAF3) (NM_020186) Human Recombinant Protein

SDHAF3 protein,

Recombinant protein of human ACN9 homolog (S. cerevisiae) (ACN9)

Product Info Summary

SKU: PROTQ9NRP4
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

ACN9 (SDHAF3) (NM_020186) Human Recombinant Protein

View all SDHAF3 recombinant proteins

SKU/Catalog Number

PROTQ9NRP4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ACN9 homolog (S. cerevisiae) (ACN9)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ACN9 (SDHAF3) (NM_020186) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NRP4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

14.5 kDa

Amino Acid Sequence

MPGRHVSRVRALYKRVLQLHRVLPPDLKSLGDQYVKDEFRRHKTVGSDEAQRFLQEWEVYATALLQQANENRQNSTGKACFGTFLPEEKLNDFRDEQIGQLQELMQEATKPNRQFSISESMKPKF

Validation Images & Assay Conditions

Gene/Protein Information For SDHAF3 (Source: Uniprot.org, NCBI)

Gene Name

SDHAF3

Full Name

Succinate dehydrogenase assembly factor 3, mitochondrial

Weight

14.5 kDa

Superfamily

complex I LYR family

Alternative Names

Succinate dehydrogenase assembly factor 3, mitochondrial SDHAF3 ACN9, DC11, LYRM10, Sdh7 succinate dehydrogenase complex assembly factor 3 succinate dehydrogenase assembly factor 3, mitochondrial|ACN9 homolog|SDH assembly factor 3|protein ACN9 homolog, mitochondrial

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SDHAF3, check out the SDHAF3 Infographic

SDHAF3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SDHAF3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NRP4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ACN9 (SDHAF3) (NM_020186) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ACN9 (SDHAF3) (NM_020186) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ACN9 (SDHAF3) (NM_020186) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NRP4
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.