Acid Phosphatase (ACP1) (NM_007099) Human Recombinant Protein

LMW-PTP/ACP1 protein,

Product Info Summary

SKU: PROTP24666
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Acid Phosphatase (ACP1) (NM_007099) Human Recombinant Protein

View all LMW-PTP/ACP1 recombinant proteins

SKU/Catalog Number

PROTP24666

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human acid phosphatase 1, soluble (ACP1), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Acid Phosphatase (ACP1) (NM_007099) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP24666)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

17.8 kDa

Amino Acid Sequence

MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH

Validation Images & Assay Conditions

Gene/Protein Information For ACP1 (Source: Uniprot.org, NCBI)

Gene Name

ACP1

Full Name

Low molecular weight phosphotyrosine protein phosphatase

Weight

17.8 kDa

Superfamily

low molecular weight phosphotyrosine protein phosphatase family

Alternative Names

acid phosphatase 1, soluble; acid phosphatase of erythrocyte; ACP1; Adipocyte acid phosphatase; cytoplasmic phosphotyrosyl protein phosphatase; EC 3.1.3.2; EC 3.1.3.48; HAAP; LMWPTP; LMW-PTP; LMW-PTPase; Low molecular weight cytosolic acid phosphatase; low molecular weight phosphotyrosine protein phosphatase; MGC111030; MGC3499; protein tyrosine phosphatase; Red cell acid phosphatase 1 ACP1 HAAP, LMW-PTP, LMWPTP acid phosphatase 1 low molecular weight phosphotyrosine protein phosphatase|LMW-PTPase|acid phosphatase 1, soluble|acid phosphatase of erythrocyte|adipocyte acid phosphatase|cytoplasmic phosphotyrosyl protein phosphatase|low molecular weight cytosolic acid phosphatase|protein tyrosine phosphatase|red cell acid phosphatase 1|testicular secretory protein Li 37

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ACP1, check out the ACP1 Infographic

ACP1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ACP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP24666

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Acid Phosphatase (ACP1) (NM_007099) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Acid Phosphatase (ACP1) (NM_007099) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Acid Phosphatase (ACP1) (NM_007099) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP24666
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.