ZNF706 (NM_016096) Human Recombinant Protein

ZNF706 protein,

Recombinant protein of human zinc finger protein 706 (ZNF706), transcript variant 2

Product Info Summary

SKU: PROTQ9Y5V0
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

ZNF706 (NM_016096) Human Recombinant Protein

View all ZNF706 recombinant proteins

SKU/Catalog Number

PROTQ9Y5V0

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human zinc finger protein 706 (ZNF706), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ZNF706 (NM_016096) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y5V0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

8.3 kDa

Amino Acid Sequence

MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFESKHPKTPLPPELADVQA

Validation Images & Assay Conditions

Gene/Protein Information For ZNF706 (Source: Uniprot.org, NCBI)

Gene Name

ZNF706

Full Name

Zinc finger protein 706

Weight

8.3 kDa

Alternative Names

Zinc finger protein 706 ZNF706 HSPC038, PNAS-106, PNAS-113 zinc finger protein 706 zinc finger protein 706

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ZNF706, check out the ZNF706 Infographic

ZNF706 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ZNF706: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y5V0

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ZNF706 (NM_016096) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ZNF706 (NM_016096) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ZNF706 (NM_016096) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y5V0
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.