ZNF581 (NM_016535) Human Recombinant Protein

Zinc finger protein 581 protein,

Recombinant protein of human zinc finger protein 581 (ZNF581)

Product Info Summary

SKU: PROTQ9P0T4
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

ZNF581 (NM_016535) Human Recombinant Protein

View all Zinc finger protein 581 recombinant proteins

SKU/Catalog Number

PROTQ9P0T4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human zinc finger protein 581 (ZNF581)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ZNF581 (NM_016535) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9P0T4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

21.8 kDa

Amino Acid Sequence

MLVLPSPCPQPLAFSSVETMEGPPRRTCRSPEPGPSSSIGSPQASSPPRPNHYLLIDTQGVPYTVLVDEESQREPGASGAPGQKKCYSCPVCSRVFEYMSYLQRHSITHSEVKPFECDICGKAFKRASHLARHHSIHLAGGGRPHGCPLCPRRFRDAGELAQHSRVHSGERPFQCPHCPRRFMEQNTLQKHTRWKHP

Validation Images & Assay Conditions

Gene/Protein Information For ZNF581 (Source: Uniprot.org, NCBI)

Gene Name

ZNF581

Full Name

Zinc finger protein 581

Weight

21.8 kDa

Alternative Names

FLJ22550; HSPC189; zinc finger protein 581 ZNF581 HSPC189 zinc finger protein 581 zinc finger protein 581

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ZNF581, check out the ZNF581 Infographic

ZNF581 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ZNF581: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9P0T4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ZNF581 (NM_016535) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ZNF581 (NM_016535) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ZNF581 (NM_016535) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9P0T4
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.