ZNF174 (NM_001032292) Human Recombinant Protein

ZNF174 protein,

Recombinant protein of human zinc finger protein 174 (ZNF174), transcript variant 2

Product Info Summary

SKU: PROTQ15697
Size: 20 µg
Source: HEK293T

Product Name

ZNF174 (NM_001032292) Human Recombinant Protein

View all ZNF174 recombinant proteins

SKU/Catalog Number

PROTQ15697

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human zinc finger protein 174 (ZNF174), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ZNF174 (NM_001032292) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ15697)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

26.7 kDa

Amino Acid Sequence

MAAKMEITLSSNTEASSKQERHIIAKLEEKRGPPLQKNCPDPELCRQSFRRFCYQEVSGPQEALSQLRQLCRQWLQPELHTKEQILELLVMEQFLTILPPEIQARVRHRCPMSSKEIVTLVEDFHRASKKPKQWVAVCMQGQKVLLEKTGSQLGEQELPDFQPQTPRRDLRESSPAEPSQAGAYDRLSPHHWEKSPLLQEPTPKLAGTELLIEKTDPNMATDELPCKLWLSFIA

Validation Images & Assay Conditions

Gene/Protein Information For ZNF174 (Source: Uniprot.org, NCBI)

Gene Name

ZNF174

Full Name

Zinc finger protein 174

Weight

26.7 kDa

Superfamily

krueppel C2H2-type zinc-finger protein family

Alternative Names

AW-1; zinc finger protein 174; ZSCAN8Zinc finger and SCAN domain-containing protein 8 ZNF174 ZSCAN8 zinc finger protein 174 zinc finger protein 174|AW-1|zinc finger and SCAN domain-containing protein 8

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ZNF174, check out the ZNF174 Infographic

ZNF174 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ZNF174: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ15697

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ZNF174 (NM_001032292) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ZNF174 (NM_001032292) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ZNF174 (NM_001032292) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ15697
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.