Y14 (RBM8A) (NM_005105) Human Recombinant Protein

RBM8A protein,

Product Info Summary

SKU: PROTQ9Y5S9
Size: 20 µg
Source: HEK293T

Product Name

Y14 (RBM8A) (NM_005105) Human Recombinant Protein

View all RBM8A recombinant proteins

SKU/Catalog Number

PROTQ9Y5S9

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human RNA binding motif protein 8A (RBM8A)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Y14 (RBM8A) (NM_005105) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y5S9)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

19.7 kDa

Amino Acid Sequence

MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR

Validation Images & Assay Conditions

Gene/Protein Information For RBM8A (Source: Uniprot.org, NCBI)

Gene Name

RBM8A

Full Name

RNA-binding protein 8A

Weight

19.7 kDa

Superfamily

RBM8A family

Alternative Names

Binder of OVCA1-1; BOV-1; BOV-1A; BOV-1B; BOV-1C; MDS014; RBM8BRBM8; ribonucleoprotein RBM8; Ribonucleoprotein RBM8A; RNA binding motif protein 8A; RNA binding motif protein 8B; RNA-binding motif protein 8A; RNA-binding protein 8A; RNA-binding protein Y14; Y14; ZNRP; ZRNP1 RBM8A BOV-1A, BOV-1B, BOV-1C, C1DELq21.1, DEL1q21.1, MDS014, RBM8, RBM8B, TAR, Y14, ZNRP, ZRNP1 RNA binding motif protein 8A RNA-binding protein 8A|BOV-1|RNA binding motif protein 8B|RNA-binding protein Y14|binder of OVCA1|binder of OVCA1-1|ribonucleoprotein RBM8|ribonucleoprotein RBM8A

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RBM8A, check out the RBM8A Infographic

RBM8A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RBM8A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y5S9

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Y14 (RBM8A) (NM_005105) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Y14 (RBM8A) (NM_005105) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Y14 (RBM8A) (NM_005105) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y5S9
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.