XAGE3 (NM_130776) Human Recombinant Protein

XAGE3 protein,

Purified recombinant protein of Homo sapiens X antigen family, member 3 (XAGE3), transcript variant 2

Product Info Summary

SKU: PROTQ8WTP9
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

XAGE3 (NM_130776) Human Recombinant Protein

View all XAGE3 recombinant proteins

SKU/Catalog Number

PROTQ8WTP9

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens X antigen family, member 3 (XAGE3), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

XAGE3 (NM_130776) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8WTP9)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

12.1 kDa

Amino Acid Sequence

MIWRGRSTYRPRPRRSVPPPELIGPMLEPGDEEPQQEEPPTESRDPAPGQEREEDQGAAETQVPDLEADLQELSQSKTGGECGNGPDDQGKILPKSEQFKMPEGGDRQPQV

Validation Images & Assay Conditions

Gene/Protein Information For XAGE3 (Source: Uniprot.org, NCBI)

Gene Name

XAGE3

Full Name

X antigen family member 3

Weight

12.1 kDa

Superfamily

GAGE family

Alternative Names

Cancer/testis antigen 12.3; cancer/testis antigen family 12, member 3a; cancer/testis antigen family 12, member 3b; CT12.3; CT12.3a; CT12.3b; G antigen family D member 4; G antigen, family D, 4; MGC71925; PLAC6GAGED4; placenta-specific 6; placenta-specific 6; G antigen, family D, 4; Placenta-specific gene 6 protein; pp9012; Protein XAGE-3; X antigen family, member 3; XAGE-3 XAGE3 CT12.3a, CT12.3b, GAGED4, PLAC6, XAGE-3, pp9012 X family member 3 X family member 3|CT12.3|G , family D, 4|cancer/testis 12.3|cancer/testis family 12, member 3a|cancer/testis family 12, member 3b|g family D member 4|placenta-specific 6|placenta-specific gene 6 protein|protein XAGE-3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on XAGE3, check out the XAGE3 Infographic

XAGE3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for XAGE3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used XAGE3 (NM_130776) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For XAGE3 (NM_130776) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for XAGE3 (NM_130776) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8WTP9
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.