WDR69 (DAW1) (NM_178821) Human Recombinant Protein

DAW1 protein,

Recombinant protein of human WD repeat domain 69 (WDR69)

Product Info Summary

SKU: PROTQ8N136
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

WDR69 (DAW1) (NM_178821) Human Recombinant Protein

View all DAW1 recombinant proteins

SKU/Catalog Number

PROTQ8N136

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human WD repeat domain 69 (WDR69)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

WDR69 (DAW1) (NM_178821) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8N136)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

45.6 kDa

Amino Acid Sequence

MKLKSLLLRYYPPGIMLEYEKHGELKTKSIDLLDLGPSTDVSALVEEIQKAEPLLTASRTEQVKLLIQRLQEKLGQNSNHTFYLFKVLKAHILPLTNVALNKSGSCFITGSYDRTCKLWDTASGEELNTLEGHRNVVYAIAFNNPYGDKIATGSFDKTCKLWSVETGKCYHTFRGHTAEIVCLSFNPQSTLVATGSMDTTAKLWDIQNGEEVYTLRGHSAEIISLSFNTSGDRIITGSFDHTVVVWDADTGRKVNILIGHCAEISSASFNWDCSLILTGSMDKTCKLWDATNGKCVATLTGHDDEILDSCFDYTGKLIATASADGTARIFSAATRKCIAKLEGHEGEISKISFNPQGNHLLTGSSDKTARIWDAQTGQCLQVLEGHTDEIFSCAFNYKGNIVITGSKDNTCRIWR

Validation Images & Assay Conditions

Gene/Protein Information For DAW1 (Source: Uniprot.org, NCBI)

Gene Name

DAW1

Full Name

Dynein assembly factor with WDR repeat domains 1

Weight

45.6 kDa

Superfamily

WD repeat WDR69 family

Alternative Names

Dynein assembly factor with WDR repeat domains 1 DAW1 ODA16, WDR69 dynein assembly factor with WD repeats 1 dynein assembly factor with WDR repeat domains 1|WD repeat domain 69|WD repeat-containing protein 69|outer row dynein assembly 16 homolog|outer row dynein assembly protein 16 homolog|testis tissue sperm-binding protein Li 93mP

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on DAW1, check out the DAW1 Infographic

DAW1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DAW1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used WDR69 (DAW1) (NM_178821) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For WDR69 (DAW1) (NM_178821) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for WDR69 (DAW1) (NM_178821) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8N136
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.