UQCRHL (NM_001089591) Human Recombinant Protein

UQCRHL protein,

Recombinant protein of human ubiquinol-cytochrome c reductase hinge protein-like (UQCRHL)

Product Info Summary

SKU: PROTA0A096LP55
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

UQCRHL (NM_001089591) Human Recombinant Protein

View all UQCRHL recombinant proteins

SKU/Catalog Number

PROTA0A096LP55

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ubiquinol-cytochrome c reductase hinge protein-like (UQCRHL)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

UQCRHL (NM_001089591) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTA0A096LP55)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

10.6 kDa

Amino Acid Sequence

MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELYDEHVSSRSHTEEDCTEELFDFLHAKDHCVAHKLFNNLK

Validation Images & Assay Conditions

Gene/Protein Information For UQCRHL (Source: Uniprot.org, NCBI)

Gene Name

UQCRHL

Full Name

Cytochrome b-c1 complex subunit 6-like, mitochondrial

Weight

10.6 kDa

Superfamily

UQCRH/QCR6 family

Alternative Names

Cytochrome b-c1 complex subunit 6-like, mitochondrial UQCRHL hCG25371 ubiquinol-cytochrome c reductase hinge protein like cytochrome b-c1 complex subunit 6-like, mitochondrial

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on UQCRHL, check out the UQCRHL Infographic

UQCRHL infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for UQCRHL: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used UQCRHL (NM_001089591) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For UQCRHL (NM_001089591) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for UQCRHL (NM_001089591) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTA0A096LP55
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.