UCHL3 (NM_006002) Human Recombinant Protein

UCH-L3 protein,

Product Info Summary

SKU: PROTP15374
Size: 20 µg
Source: HEK293T

Product Name

UCHL3 (NM_006002) Human Recombinant Protein

View all UCH-L3 recombinant proteins

SKU/Catalog Number

PROTP15374

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

UCHL3 (NM_006002) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP15374)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

26 kDa

Amino Acid Sequence

MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA

Validation Images & Assay Conditions

Gene/Protein Information For UCHL3 (Source: Uniprot.org, NCBI)

Gene Name

UCHL3

Full Name

Ubiquitin carboxyl-terminal hydrolase isozyme L3

Weight

26 kDa

Superfamily

peptidase C12 family

Alternative Names

EC 3.4.19.12; ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase); ubiquitin carboxyl-terminal hydrolase isozyme L3; Ubiquitin Thioesterase L3; ubiquitin thiolesterase; UCHL3; UCH-L3 UCHL3 UCH-L3 ubiquitin C-terminal hydrolase L3 ubiquitin carboxyl-terminal hydrolase isozyme L3|testicular tissue protein Li 221|ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)|ubiquitin thioesterase L3|ubiquitin thiolesterase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on UCHL3, check out the UCHL3 Infographic

UCHL3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for UCHL3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP15374

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used UCHL3 (NM_006002) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For UCHL3 (NM_006002) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for UCHL3 (NM_006002) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP15374
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.