UBLCP1 (NM_145049) Human Recombinant Protein

Ublcp1 protein,

Product Info Summary

SKU: PROTQ8WVY7
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

UBLCP1 (NM_145049) Human Recombinant Protein

View all Ublcp1 recombinant proteins

SKU/Catalog Number

PROTQ8WVY7

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ubiquitin-like domain containing CTD phosphatase 1 (UBLCP1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

UBLCP1 (NM_145049) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8WVY7)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

36.6 kDa

Amino Acid Sequence

MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKLKPNTKIMMMGTREESLEDVLGPPPDNDDVVNDFDIEDEVVEVENREENLLKISRRVKEYKVEILNPPREGKKLLVLDVDYTLFDHRSCAETGVELMRPYLHEFLTSAYEDYDIVIWSATNMKWIEAKMKELGVSTNANYKITFMLDSAAMITVHTPRRGLIDVKPLGVIWGKFSEFYSKKNTIMFDDIGRNFLMNPQNGLKIRPFMKAHLNRDKDKELLKLTQYLKEIAKLDDFLDLNHKYWERYLSKKQGQ

Validation Images & Assay Conditions

Gene/Protein Information For UBLCP1 (Source: Uniprot.org, NCBI)

Gene Name

UBLCP1

Full Name

Ubiquitin-like domain-containing CTD phosphatase 1

Weight

36.6 kDa

Alternative Names

CPUB1; CTD phosphatase-like with ubiquitin domain 1; CTD-like phosphatase domain-containing protein; EC 3.1.3.16; FLJ25267; MGC10067; ubiquitin-like domain containing CTD phosphatase 1; ubiquitin-like domain-containing CTD phosphatase 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on UBLCP1, check out the UBLCP1 Infographic

UBLCP1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for UBLCP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8WVY7

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used UBLCP1 (NM_145049) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For UBLCP1 (NM_145049) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for UBLCP1 (NM_145049) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8WVY7
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product