UBE2D2 (NM_181838) Human Recombinant Protein

UbcH5b/UBE2D2 protein,

Product Info Summary

SKU: PROTP62837
Size: 20 µg
Source: HEK293T

Product Name

UBE2D2 (NM_181838) Human Recombinant Protein

View all UbcH5b/UBE2D2 recombinant proteins

SKU/Catalog Number

PROTP62837

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast) (UBE2D2), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

UBE2D2 (NM_181838) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP62837)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

13.5 kDa

Amino Acid Sequence

MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM

Validation Images & Assay Conditions

Gene/Protein Information For UBE2D2 (Source: Uniprot.org, NCBI)

Gene Name

UBE2D2

Full Name

Ubiquitin-conjugating enzyme E2 D2

Weight

13.5 kDa

Superfamily

ubiquitin-conjugating enzyme family

Alternative Names

E2(17)KB2; EC 6.3.2.19; PUBC1; UBC4/5; UBC4ubiquitin-conjugating enzyme E2D 2 (homologous to yeast UBC4/5); UBC5B; UBCH4; UbcH5b; UBE2D2; Ubiquitin carrier protein D2; ubiquitin-conjugating enzyme E2 D2; Ubiquitin-conjugating enzyme E2(17)KB 2; Ubiquitin-conjugating enzyme E2-17 kDa 2; ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast); Ubiquitin-protein ligase D2 UBE2D2 E2(17)KB2, PUBC1, UBC4, UBC4/5, UBCH4, UBCH5B ubiquitin conjugating enzyme E2 D2 ubiquitin-conjugating enzyme E2 D2|(E3-independent) E2 ubiquitin-conjugating enzyme D2|E2 ubiquitin-conjugating enzyme D2|p53-regulated ubiquitin-conjugating enzyme 1|ubiquitin carrier protein D2|ubiquitin conjugating enzyme E2D 2|ubiquitin-conjugating enzyme E2-17 kDa 2|ubiquitin-conjugating enzyme E2D 2 (homologous to yeast UBC4/5)|ubiquitin-protein ligase D2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on UBE2D2, check out the UBE2D2 Infographic

UBE2D2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for UBE2D2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP62837

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used UBE2D2 (NM_181838) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For UBE2D2 (NM_181838) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for UBE2D2 (NM_181838) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP62837
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product