TXNL4A (NM_006701) Human Recombinant Protein

TXNL4A protein,

Product Info Summary

SKU: PROTP83876
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

TXNL4A (NM_006701) Human Recombinant Protein

View all TXNL4A recombinant proteins

SKU/Catalog Number

PROTP83876

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human thioredoxin-like 4A (TXNL4A)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TXNL4A (NM_006701) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP83876)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

16.6 kDa

Amino Acid Sequence

MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY

Validation Images & Assay Conditions

Gene/Protein Information For TXNL4A (Source: Uniprot.org, NCBI)

Gene Name

TXNL4A

Full Name

Thioredoxin-like protein 4A

Weight

16.6 kDa

Superfamily

DIM1 family

Alternative Names

DIB1; DIM1 protein homolog; DIM1Thioredoxin-like U5 snRNP protein U5-15kD; HsT161; Spliceosomal U5 snRNP-specific 15 kDa protein; thioredoxin-like 4; thioredoxin-like 4A; thioredoxin-like protein 4A; TXNL4; U5-15kD TXNL4A BMKS, DIB1, DIM1, SNRNP15, TXNL4, U5-15kD thioredoxin like 4A thioredoxin-like protein 4A|DIM1 protein homolog|spliceosomal U5 snRNP-specific 15 kDa protein|thioredoxin-like 4|thioredoxin-like U5 snRNP protein U5-15kD

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TXNL4A, check out the TXNL4A Infographic

TXNL4A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TXNL4A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP83876

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TXNL4A (NM_006701) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TXNL4A (NM_006701) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TXNL4A (NM_006701) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP83876
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.