TTDA (GTF2H5) (NM_207118) Human Recombinant Protein

Gtf2h5 protein,

Product Info Summary

SKU: PROTQ6ZYL4
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

TTDA (GTF2H5) (NM_207118) Human Recombinant Protein

View all Gtf2h5 recombinant proteins

SKU/Catalog Number

PROTQ6ZYL4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human general transcription factor IIH, polypeptide 5 (GTF2H5)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TTDA (GTF2H5) (NM_207118) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ6ZYL4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

7.9 kDa

Amino Acid Sequence

MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFSLTQK

Validation Images & Assay Conditions

Gene/Protein Information For GTF2H5 (Source: Uniprot.org, NCBI)

Gene Name

GTF2H5

Full Name

General transcription factor IIH subunit 5

Weight

7.9 kDa

Superfamily

TFB5 family

Alternative Names

General transcription factor IIH subunit 5

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GTF2H5, check out the GTF2H5 Infographic

GTF2H5 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GTF2H5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ6ZYL4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TTDA (GTF2H5) (NM_207118) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TTDA (GTF2H5) (NM_207118) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TTDA (GTF2H5) (NM_207118) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ6ZYL4
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.