TTC9C (NM_173810) Human Recombinant Protein

Ttc9c protein,

Recombinant protein of human tetratricopeptide repeat domain 9C (TTC9C)

Product Info Summary

SKU: PROTQ8N5M4
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

TTC9C (NM_173810) Human Recombinant Protein

View all Ttc9c recombinant proteins

SKU/Catalog Number

PROTQ8N5M4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human tetratricopeptide repeat domain 9C (TTC9C)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TTC9C (NM_173810) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8N5M4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

19.8 kDa

Amino Acid Sequence

MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLPNLGPQGPALTPEQENILHTTQTDCYNNLAACLLQMEPVNYERVREYSQKVLERQPDNAKALYRAGVAFFHLQDYDQARHYLLAAVNRQPKDANVRRYLQLTQSELSSYHRKEKQLYLGMFG

Validation Images & Assay Conditions

Gene/Protein Information For TTC9C (Source: Uniprot.org, NCBI)

Gene Name

TTC9C

Full Name

Tetratricopeptide repeat protein 9C

Weight

19.8 kDa

Superfamily

TTC9 family

Alternative Names

MGC29649; tetratricopeptide repeat domain 9C; tetratricopeptide repeat protein 9C; TPR repeat protein 9C

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TTC9C, check out the TTC9C Infographic

TTC9C infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TTC9C: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used TTC9C (NM_173810) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TTC9C (NM_173810) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TTC9C (NM_173810) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8N5M4
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.