TTC30A (NM_152275) Human Recombinant Protein

FLJ13946 protein,

Recombinant protein of human tetratricopeptide repeat domain 30A (TTC30A)

Product Info Summary

SKU: PROTQ86WT1
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

TTC30A (NM_152275) Human Recombinant Protein

View all FLJ13946 recombinant proteins

SKU/Catalog Number

PROTQ86WT1

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human tetratricopeptide repeat domain 30A (TTC30A)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TTC30A (NM_152275) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ86WT1)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

76 kDa

Amino Acid Sequence

MAGLSGAQIPDGEFTALVYRLIRDARYAEAVQLLGRELQRSPRSRAGLSLLGYCYYRLQEFALAAECYEQLGQLHPELEQYRLYQAQALYKACLYPEATRVAFLLLDNPAYHSRVLRLQAAIKYSEGDLPGSRSLVEQLLSGEGGEESGGDNETDGQVNLGCLLYKEGQYEAACSKFSATLQASGYQPDLSYNLALAYYSSRQYASALKHIAEIIERGIRQHPELGVGMTTEGFDVRSVGNTLVLHQTALVEAFNLKAAIEYQLRNYEVAQETLTDMPPRAEEELDPVTLHNQALMNMDARPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLTYKFLTPYLYDFLDALITCQTAPEEAFIKLDGLAGMLTEQLRRLTKQVQEARHNRDDEAIKKAVNEYDETMEKYIPVLMAQAKIYWNLENYPMVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKHYDNILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYDDPNRKMYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYNKRLGTDTWYYAKRCFLSLLENMSKHMIVIHDSVIQECVQFLGHCELYGTNIPAVIEQPLEEERMHVGKNTVTDESRQLKALIYEIIGWNK

Validation Images & Assay Conditions

Gene/Protein Information For TTC30A (Source: Uniprot.org, NCBI)

Gene Name

TTC30A

Full Name

Tetratricopeptide repeat protein 30A

Weight

76 kDa

Superfamily

TTC30/dfy-1/fleer family

Alternative Names

FLJ13946; FLJ77601; IFT70A; tetratricopeptide repeat domain 30A; tetratricopeptide repeat protein 30A; TPR repeat protein 30A TTC30A FAP259, IFT70A, TTC30B tetratricopeptide repeat domain 30A tetratricopeptide repeat protein 30A|TPR repeat protein 30A|TPR repeat protein 30B|Tetratricopeptide repeat protein 30B

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TTC30A, check out the TTC30A Infographic

TTC30A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TTC30A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used TTC30A (NM_152275) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TTC30A (NM_152275) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TTC30A (NM_152275) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ86WT1
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.