TPSG1 (NM_012467) Human Recombinant Protein

Tryptase gamma-1/TPSG1 protein,

Recombinant protein of human tryptase gamma 1 (TPSG1)

Product Info Summary

SKU: PROTQ9NRR2
Size: 20 µg
Source: HEK293T

Product Name

TPSG1 (NM_012467) Human Recombinant Protein

View all Tryptase gamma-1/TPSG1 recombinant proteins

SKU/Catalog Number

PROTQ9NRR2

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human tryptase gamma 1 (TPSG1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TPSG1 (NM_012467) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NRR2)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

32 kDa

Amino Acid Sequence

MALGACGLLLLLAVPGVSLRTLQPGCGRPQVSDAGGRIVGGHAAPAGAWPWQASLRLRRMHVCGGSLLSPQWVLTAAHCFSGSLNSSDYQVHLGELEITLSPHFSTVRQIILHSSPSGQPGTSGDIALVELSVPVTLSSRILPVCLPEASDDFCPGIRCSVTGWGYTREGEPLPPPYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLCARGPGDACQDDSGGPLVCQVNGAWVQAGIVSWGEGCGRPNRPGVYTRVPAYVNWIRRHITASGGSESGYPRLPLLAGFFLPGLFLLLVSCVLLAKCLLHPSADGTPFPAPD

Validation Images & Assay Conditions

Gene/Protein Information For TPSG1 (Source: Uniprot.org, NCBI)

Gene Name

TPSG1

Full Name

Tryptase gamma

Weight

32 kDa

Superfamily

peptidase S1 family

Alternative Names

EC 3.4.21; EC 3.4.21.-; gamma I; gamma II; lung tryptase; mast cell protease II; mast cell tryptase; PRSS31skin tryptase; Serine protease 31; TMTpituitary tryptase; TPSG1; Transmembrane tryptase; trpA; tryptase gamma 1; tryptase gamma I; tryptase gamma II; tryptase gamma; Tryptase gamma1; Tryptase gamma-1 TPSG1 PRSS31, TMT, trpA tryptase gamma 1 tryptase gamma|serine protease 31|transmembrane tryptase|tryptase gamma I|tryptase gamma II

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TPSG1, check out the TPSG1 Infographic

TPSG1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TPSG1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NRR2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TPSG1 (NM_012467) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TPSG1 (NM_012467) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TPSG1 (NM_012467) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NRR2
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product