TPPP2 (NM_173846) Human Recombinant Protein

TPPP2 protein,

Recombinant protein of human tubulin polymerization-promoting protein family member 2 (TPPP2)

Product Info Summary

SKU: PROTP59282
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

TPPP2 (NM_173846) Human Recombinant Protein

View all TPPP2 recombinant proteins

SKU/Catalog Number

PROTP59282

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human tubulin polymerization-promoting protein family member 2 (TPPP2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TPPP2 (NM_173846) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP59282)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

18.3 kDa

Amino Acid Sequence

MASEAEKTFHRFAAFGESSSSGTEMNNKNFSKLCKDCGIMDGKTVTSTDVDIVFSKVKAKNARTITFQQFKEAVKELGQKRFKGKSPDEVLENIYGLMEGKDPATTGATKATTVGAVDRLTDTSKYTGTHKELFDESGKGKGIAGREEMTDNTGYVSGYKGSGTYDKKTK

Validation Images & Assay Conditions

Gene/Protein Information For TPPP2 (Source: Uniprot.org, NCBI)

Gene Name

TPPP2

Full Name

Tubulin polymerization-promoting protein family member 2

Weight

18.3 kDa

Superfamily

TPPP family

Alternative Names

Tubulin polymerization-promoting protein family member 2 TPPP2 C14orf8, CT152, P18, p25beta tubulin polymerization promoting protein family member 2 tubulin polymerization-promoting protein family member 2|TPPP/p18|protein p25-beta

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TPPP2, check out the TPPP2 Infographic

TPPP2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TPPP2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP59282

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TPPP2 (NM_173846) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TPPP2 (NM_173846) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TPPP2 (NM_173846) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP59282
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.