TMEM190 (NM_139172) Human Recombinant Protein

Tmem190 protein,

Recombinant protein of human transmembrane protein 190 (TMEM190)

Product Info Summary

SKU: PROTQ8WZ59
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

TMEM190 (NM_139172) Human Recombinant Protein

View all Tmem190 recombinant proteins

SKU/Catalog Number

PROTQ8WZ59

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human transmembrane protein 190 (TMEM190)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TMEM190 (NM_139172) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8WZ59)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

19.3 kDa

Amino Acid Sequence

MLGCGIPALGLLLLLQGSADGNGIQGFFYPWSCEGDIWDRESCGGQAAIDSPNLCLRLRCCYRNGVCYHQRPDENVRRKHMWALVWTCSGLLLLSCSICLFWWAKRRDVLHMPGFLAGPCDMSKSVSLLSKHRGTKKTPSTGSVPVALSKESRDVEGGTEGEGTEEGEETEGEEEED

Validation Images & Assay Conditions

Gene/Protein Information For TMEM190 (Source: Uniprot.org, NCBI)

Gene Name

TMEM190

Full Name

Transmembrane protein 190

Weight

19.3 kDa

Alternative Names

Transmembrane protein 190

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TMEM190, check out the TMEM190 Infographic

TMEM190 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TMEM190: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8WZ59

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TMEM190 (NM_139172) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TMEM190 (NM_139172) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TMEM190 (NM_139172) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8WZ59
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.