TIMM8B (NM_012459) Human Recombinant Protein

TIMM8B protein,

Recombinant protein of human translocase of inner mitochondrial membrane 8 homolog B (yeast) (TIMM8B), nuclear gene encoding mitochondrial protein, transcript variant 1.

Product Info Summary

SKU: PROTQ9Y5J9
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

TIMM8B (NM_012459) Human Recombinant Protein

View all TIMM8B recombinant proteins

SKU/Catalog Number

PROTQ9Y5J9

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human translocase of inner mitochondrial membrane 8 homolog B (yeast) (TIMM8B), nuclear gene encoding mitochondrial protein, transcript variant 1.

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TIMM8B (NM_012459) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y5J9)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

11 kDa

Amino Acid Sequence

MRKHSCRKVASLRRTMAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGGQ

Validation Images & Assay Conditions

Gene/Protein Information For TIMM8B (Source: Uniprot.org, NCBI)

Gene Name

TIMM8B

Full Name

Mitochondrial import inner membrane translocase subunit Tim8 B

Weight

11 kDa

Superfamily

small Tim family

Alternative Names

DDP2DDP-like protein; DDPL; Deafness dystonia protein 2; FLJ21744; MGC102866; MGC117373; mitochondrial import inner membrane translocase subunit Tim8 B; TIM8Btranslocase of inner mitochondrial membrane 8 (yeast) homolog B; translocase of inner mitochondrial membrane 8 homolog B (yeast) TIMM8B DDP2, TIM8B translocase of inner mitochondrial membrane 8 homolog B mitochondrial import inner membrane translocase subunit Tim8 B|DDP-like protein|deafness dystonia protein 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TIMM8B, check out the TIMM8B Infographic

TIMM8B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TIMM8B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y5J9

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TIMM8B (NM_012459) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TIMM8B (NM_012459) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TIMM8B (NM_012459) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y5J9
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.