TBCEL (NM_152715) Human Recombinant Protein

LRRC35 protein,

Product Info Summary

SKU: PROTQ5QJ74
Size: 20 µg
Source: HEK293T

Product Name

TBCEL (NM_152715) Human Recombinant Protein

View all LRRC35 recombinant proteins

SKU/Catalog Number

PROTQ5QJ74

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human tubulin folding cofactor E-like (TBCEL), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TBCEL (NM_152715) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ5QJ74)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

48 kDa

Amino Acid Sequence

MDQPSGRSFMQVLCEKYSPENFPYRRGPGMGVHVPATPQGSPMKDRLNLPSVLVLNSCGITCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVPQLEFLNLSSNPLNLSVLERTCAGSFSGVRKLVLNNSKASWETVHMILQELPDLEELFLCLNDYETVSCPSICCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANNHLNAIEEPDDSLARLFPNLRSISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIARLPSVSKLNGSVVTDGEREDSERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLAEVDLRPQSSAKVEVHFNDQVEEMSIRLDQTVAELKKQLKTLVQLPTSNMLLYYFDHEAPFGPEEMKYSSRALHSFGIRDGDKIYVESKTK

Validation Images & Assay Conditions

Gene/Protein Information For TBCEL (Source: Uniprot.org, NCBI)

Gene Name

TBCEL

Full Name

Tubulin-specific chaperone cofactor E-like protein

Weight

48 kDa

Alternative Names

tubulin-specific chaperone cofactor E-like protein; El; LRRC35; tubulin folding cofactor E-like TBCEL El, LRRC35 tubulin folding cofactor E like tubulin-specific chaperone cofactor E-like protein|E-like|catastrophin|leucine rich repeat containing 35|leucine-rich repeat-containing protein 35|tubulin-specific chaperone e-like

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TBCEL, check out the TBCEL Infographic

TBCEL infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TBCEL: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ5QJ74

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TBCEL (NM_152715) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TBCEL (NM_152715) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TBCEL (NM_152715) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ5QJ74
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.