SYNJ2BP (NM_018373) Human Recombinant Protein

SYNJ2BP/ARIP2 protein,

Product Info Summary

SKU: PROTP57105
Size: 20 µg
Source: HEK293T

Product Name

SYNJ2BP (NM_018373) Human Recombinant Protein

View all SYNJ2BP/ARIP2 recombinant proteins

SKU/Catalog Number

PROTP57105

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human synaptojanin 2 binding protein (SYNJ2BP)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SYNJ2BP (NM_018373) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP57105)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

15.7 kDa

Amino Acid Sequence

MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGEGDPSGIPIFMVLVPVFALTMVAAWAFMRYRQQL

Validation Images & Assay Conditions

Gene/Protein Information For SYNJ2BP (Source: Uniprot.org, NCBI)

Gene Name

SYNJ2BP

Full Name

Synaptojanin-2-binding protein

Weight

15.7 kDa

Alternative Names

activin receptor interacting protein 5; ARIP2; FLJ11271; Mitochondrial outer membrane protein 25; OMP25FLJ41973; synaptojanin 2 binding protein; synaptojanin-2-binding protein Synj2bp|A, AA409442, ARIP2, ActRIP4, D12Wsu118, D12Wsu118e, OMP, OMP25|synaptojanin 2 binding protein|synaptojanin-2-binding protein|activin receptor interacting protein 2|activin receptor-interacting protein 4|mitochondrial outer membrane protein 25|outer membrane protein 25

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SYNJ2BP, check out the SYNJ2BP Infographic

SYNJ2BP infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SYNJ2BP: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP57105

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SYNJ2BP (NM_018373) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SYNJ2BP (NM_018373) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SYNJ2BP (NM_018373) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP57105
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.