Click image to see more details
Product Info Summary
| SKU: | PROTQ95253 |
|---|---|
| Size: | 5ug,20ug |
| Origin Species: | Swine |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Swine recombinant IL-15 (Interleukin-15) protein, AF
View all IL-15 recombinant proteins
SKU/Catalog Number
PROTQ95253
Size
5ug,20ug
Tag
His Tag (N-term)
Description
Interleukin 15 (IL-15) is a 12.65 kDa cytokine with 114 amino acid residues and is primarily produced from mononuclear phagocytes like dendritic cells, monocytes, and macrophages. IL-15 plays a critical role in the innate immune system when IL-15 binds to the IL-15 receptor. In addition, IL-15 mediates biological functions, such as the proliferation of natural killer cells and T cells, preventing the immune cells from apoptosis by activating STAT3 /JAK and PI3K/ALT signaling pathways.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Swine recombinant IL-15 (Interleukin-15) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ95253)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>95% as determined by SDS-PAGE.
Predicted MW
18.086kDa
Molecular weight
The protein has a calculated MW of 14.06 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce proliferation in TF-1 cells. The ED₅₀ for this effect is <5.5 ng/mL.
Endotoxin
<0.01 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
TWQHVISDLKKIEDLIRSIHMDATLYTESDAHPNCKVTAMKCFLLELRVILQESRNSDISDTVENLIILANSSLSSIEYKTESGCKECEELEEKNINEFLKSFIHIVQMFINPS with polyhistidine tag at the N-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant swine IL-15
Protein Target Info & Infographic
Gene/Protein Information For IL15 (Source: Uniprot.org, NCBI)
Gene Name
IL15
Full Name
Interleukin-15
Weight
18.086kDa
Superfamily
IL-15/IL-21 family
Alternative Names
IL-T, IL15 IL15 IL-15 interleukin 15 interleukin-15
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IL15, check out the IL15 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IL15: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Swine recombinant IL-15 (Interleukin-15) protein, AF (PROTQ95253)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Swine recombinant IL-15 (Interleukin-15) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Swine recombinant IL-15 (Interleukin-15) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
