Product Info Summary
SKU: | PROTP16545 |
---|---|
Size: | 5ug,20ug |
Origin Species: | Swine |
Source: | Escherichia coli |
Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Swine recombinant IGF-I (Insulin-like growth factor-I) protein, AF
View all IGF-I/IGF-1 recombinant proteins
SKU/Catalog Number
PROTP16545
Size
5ug,20ug
Tag
His Tag (C-term)
Description
Insulin Like Growth Factors 1 (IGF-I) is a 7.79 kDa member of the Insulin-like Growth Factors with 71 amino acid residues. IGF-I is mainly expressed from liver, adipose tissue, cervi, endometrial stromal cells, leydig cells, and can be isolated from plasma. IGF-I is mediating the protein anabolic and promoting effect of pituitary growth hormone. IGF-I also affects metabolism of glycogen, DNA synthesis and glucose uptake via binding to IGF-I receptor.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Swine recombinant IGF-I (Insulin-like growth factor-I) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP16545)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
21.841kDa
Molecular weight
The protein has a calculated MW of 8.59 kDa. The protein migrates below 11 kDa under reducing condition (SDS-PAGE analysis).
Activity
Testing in process
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant swine IGF-I
Protein Target Info & Infographic
Gene/Protein Information For IGF1 (Source: Uniprot.org, NCBI)
Gene Name
IGF1
Full Name
Insulin-like growth factor I
Weight
21.841kDa
Superfamily
insulin family
Alternative Names
IGF-1, Npt2B IGF1 IGF, IGF-I, IGFI, MGF insulin like growth factor 1 insulin-like growth factor I|insulin-like growth factor 1 (somatomedin C)|insulin-like growth factor IB|mechano growth factor|somatomedin-C
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IGF1, check out the IGF1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IGF1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Swine recombinant IGF-I (Insulin-like growth factor-I) protein, AF (PROTP16545)
Hello CJ!
No publications found for PROTP16545
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Swine recombinant IGF-I (Insulin-like growth factor-I) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Swine recombinant IGF-I (Insulin-like growth factor-I) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question