Swine recombinant IGF-I (Insulin-like growth factor-I) protein, AF

IGF-I/IGF-1 protein, Swine

Insulin Like Growth Factors 1 (IGF-I) is a 7.79 kDa member of the Insulin-like Growth Factors with 71 amino acid residues. IGF-I is mainly expressed from liver, adipose tissue, cervi, endometrial stromal cells, leydig cells, and can be isolated from plasma. IGF-I is mediating the protein anabolic and promoting effect of pituitary growth hormone. IGF-I also affects metabolism of glycogen, DNA synthesis and glucose uptake via binding to IGF-I receptor.

Product Info Summary

SKU: PROTP16545
Size: 5ug,20ug
Origin Species: Swine
Source: Escherichia coli
Application: Cell Culture

Product Name

Swine recombinant IGF-I (Insulin-like growth factor-I) protein, AF

View all IGF-I/IGF-1 recombinant proteins

SKU/Catalog Number

PROTP16545

Size

5ug,20ug

Tag

His Tag (C-term)

Description

Insulin Like Growth Factors 1 (IGF-I) is a 7.79 kDa member of the Insulin-like Growth Factors with 71 amino acid residues. IGF-I is mainly expressed from liver, adipose tissue, cervi, endometrial stromal cells, leydig cells, and can be isolated from plasma. IGF-I is mediating the protein anabolic and promoting effect of pituitary growth hormone. IGF-I also affects metabolism of glycogen, DNA synthesis and glucose uptake via binding to IGF-I receptor.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Swine recombinant IGF-I (Insulin-like growth factor-I) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP16545)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

21.841kDa

Molecular weight

The protein has a calculated MW of 8.59 kDa. The protein migrates below 11 kDa under reducing condition (SDS-PAGE analysis).

Activity

Testing in process

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

MGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA with polyhistidine tag at the C-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Gene/Protein Information For IGF1 (Source: Uniprot.org, NCBI)

Gene Name

IGF1

Full Name

Insulin-like growth factor I

Weight

21.841kDa

Superfamily

insulin family

Alternative Names

IGF-1, Npt2B IGF1 IGF, IGF-I, IGFI, MGF insulin like growth factor 1 insulin-like growth factor I|insulin-like growth factor 1 (somatomedin C)|insulin-like growth factor IB|mechano growth factor|somatomedin-C

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on IGF1, check out the IGF1 Infographic

IGF1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for IGF1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP16545

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Swine recombinant IGF-I (Insulin-like growth factor-I) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Swine recombinant IGF-I (Insulin-like growth factor-I) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Swine recombinant IGF-I (Insulin-like growth factor-I) protein, AF

Size

Total: $154

SKU:PROTP16545

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTP16545
$154.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.