Swine recombinant GM-CSF (Granulocyte-macrophage colony-stimulating factor) protein, AF

GM-CSF protein, Swine

Granulocyte-macrophage colony-stimulating factor (GM-CSF) was first identified as a Growth Factors due to its ability to induce proliferation and differentiation of bone marrow progenitors into granulocytes and macrophages. GM-CSF is produced by multiple cell types including activated T cells, B cells, macrophages, endothelial cells and fibroblasts upon receiving immune stimuli. GM-CSF stimulates stem cells to produce granulocytes and monocytes functions as a cytokine.

Product Info Summary

SKU: PROTQ29118-1
Size: 5ug,20ug
Origin Species: Swine
Source: Escherichia coli
Application: Cell Culture

Product Name

Swine recombinant GM-CSF (Granulocyte-macrophage colony-stimulating factor) protein, AF

View all GM-CSF recombinant proteins

SKU/Catalog Number

PROTQ29118-1

Size

5ug,20ug

Tag

His Tag (N-term)

Description

Granulocyte-macrophage colony-stimulating factor (GM-CSF) was first identified as a Growth Factors due to its ability to induce proliferation and differentiation of bone marrow progenitors into granulocytes and macrophages. GM-CSF is produced by multiple cell types including activated T cells, B cells, macrophages, endothelial cells and fibroblasts upon receiving immune stimuli. GM-CSF stimulates stem cells to produce granulocytes and monocytes functions as a cytokine.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Swine recombinant GM-CSF (Granulocyte-macrophage colony-stimulating factor) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ29118-1)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

16.295kDa

Molecular weight

The protein has a calculated MW of 15.3 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to induce proliferation in TF-1 cells. The ED₅₀ for this effect is <3 ng/mL.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

APTRPPSPVTRPWQHVDAIKEALSLLNNSNDTAAVMNETVDVVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTLLAKHYEQHCPLTEETSCETQSITFKSFKDSLNKFLFTIPFDCWGPVKK with polyhistidine tag at the N-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Gene/Protein Information For CSF2 (Source: Uniprot.org, NCBI)

Gene Name

CSF2

Full Name

Granulocyte-macrophage colony-stimulating factor

Weight

16.295kDa

Superfamily

GM-CSF family

Alternative Names

CSF2 CSF2 CSF, GMCSF colony stimulating factor 2 granulocyte-macrophage colony-stimulating factor|colony stimulating factor 2 (granulocyte-macrophage)|granulocyte macrophage-colony stimulating factor|molgramostim|molgramostin|sargramostim

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CSF2, check out the CSF2 Infographic

CSF2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CSF2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ29118-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Swine recombinant GM-CSF (Granulocyte-macrophage colony-stimulating factor) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Swine recombinant GM-CSF (Granulocyte-macrophage colony-stimulating factor) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Swine recombinant GM-CSF (Granulocyte-macrophage colony-stimulating factor) protein, AF

Size

Total: $154

SKU:PROTQ29118-1

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTQ29118-1
$154.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.