SULT2A1 (NM_003167) Human Recombinant Protein

Cytosolic Sulfotransferase 2A1/SULT2A1 protein,

Product Info Summary

SKU: PROTQ06520
Size: 20 µg
Source: HEK293T

Product Name

SULT2A1 (NM_003167) Human Recombinant Protein

View all Cytosolic Sulfotransferase 2A1/SULT2A1 recombinant proteins

SKU/Catalog Number

PROTQ06520

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human sulfotransferase family, cytosolic, 2A, dehydroepiandrosterone (DHEA)-preferring, member 1 (SULT2A1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SULT2A1 (NM_003167) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ06520)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

33.6 kDa

Amino Acid Sequence

MSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE

Validation Images & Assay Conditions

Gene/Protein Information For SULT2A1 (Source: Uniprot.org, NCBI)

Gene Name

SULT2A1

Full Name

Bile salt sulfotransferase

Weight

33.6 kDa

Superfamily

sulfotransferase 1 family

Alternative Names

alcohol/hydroxysteroid sulfotransferase; Cytosolic Sulfotransferase 2A1; Dehydroepiandrosterone sulfotransferase; DHEAS; DHEA-ST; DHEA-STbile salt sulfotransferase; EC 2.8.2.14; HST; hSTa; Hydroxysteroid Sulfotransferase; ST2; ST2A1; ST2A3; STDbile-salt sulfotranasferase 2A1; Sulfotransferase 2A1; sulfotransferase family, cytosolic, 2A, dehydroepiandrosterone(DHEA)-preferring, member 1; SULT2A1 SULT2A1 DHEA-ST, DHEA-ST8, DHEAS, HST, ST2, ST2A1, ST2A3, STD, SULT2A3, hSTa sulfotransferase family 2A member 1 sulfotransferase 2A1|alcohol/hydroxysteroid sulfotransferase|bile-salt sulfotranasferase 2A1|sulfotransferase family, cytosolic, 2A, dehydroepiandrosterone (DHEA)-preferring, member 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SULT2A1, check out the SULT2A1 Infographic

SULT2A1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SULT2A1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ06520

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SULT2A1 (NM_003167) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SULT2A1 (NM_003167) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SULT2A1 (NM_003167) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ06520
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.