Stathmin 1 (STMN1) (NM_203401) Human Recombinant Protein

Stathmin 1 protein,

Product Info Summary

SKU: PROTP16949
Size: 20 µg
Source: HEK293T

Product Name

Stathmin 1 (STMN1) (NM_203401) Human Recombinant Protein

View all Stathmin 1 recombinant proteins

SKU/Catalog Number

PROTP16949

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human stathmin 1/oncoprotein 18 (STMN1), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Stathmin 1 (STMN1) (NM_203401) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP16949)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

17.1 kDa

Amino Acid Sequence

MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDFSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD

Validation Images & Assay Conditions

Gene/Protein Information For STMN1 (Source: Uniprot.org, NCBI)

Gene Name

STMN1

Full Name

Stathmin

Weight

17.1 kDa

Superfamily

stathmin family

Alternative Names

C1orf215; chromosome 1 open reading frame 215; Lag; Leukemia-associated phosphoprotein p18; metablastin; MGC138869; Oncoprotein 18; Op18; OP18MGC138870; phosphoprotein 19; Phosphoprotein p19; PP17; PP19; PR22; prosolin; Protein Pr22; SMNLAP18FLJ32206; stathmin 1; stathmin 1/oncoprotein 18; stathmin; transmembrane protein C1orf215 STMN1 C1orf215, LAP18, Lag, OP18, PP17, PP19, PR22, SMN stathmin 1 stathmin|leukemia-associated phosphoprotein p18|metablastin|oncoprotein 18|phosphoprotein 19|phosphoprotein p19|prosolin|stathmin 1/oncoprotein 18|testicular tissue protein Li 189|transmembrane protein C1orf215

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on STMN1, check out the STMN1 Infographic

STMN1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for STMN1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used Stathmin 1 (STMN1) (NM_203401) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Stathmin 1 (STMN1) (NM_203401) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Stathmin 1 (STMN1) (NM_203401) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP16949
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.