SRRP35 (SRSF12) (NM_080743) Human Recombinant Protein

SRrp35 protein,

Recombinant protein of human serine-arginine repressor protein (35 kDa) (SRrp35)

Product Info Summary

SKU: PROTQ8WXF0
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SRRP35 (SRSF12) (NM_080743) Human Recombinant Protein

View all SRrp35 recombinant proteins

SKU/Catalog Number

PROTQ8WXF0

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human serine-arginine repressor protein (35 kDa) (SRrp35)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SRRP35 (SRSF12) (NM_080743) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8WXF0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

30.3 kDa

Amino Acid Sequence

MSRYTRPPNTSLFIRNVADATRPEDLRREFGRYGPIVDVYIPLDFYTRRPRGFAYVQFEDVRGAEDALYNLNRKWVCGRQIEIQFAQGDRKTPGQMKSKERHPCSPSDHRRSRSPSQRRTRSRSSSWGRNRRRSDSLKESRHRRFSYSKSKSRSKSLPRRSTSARQSRTPRRNFGSRGRSRSKSLQKRSKSIGKSQSSSPQKQTSSGTKSRSHGRHSDSIARSPCKSPKGYTNSETKVQTAKHSHFRSHSRSRSYRHKNSW

Validation Images & Assay Conditions

Gene/Protein Information For SRSF12 (Source: Uniprot.org, NCBI)

Gene Name

SRSF12

Full Name

Serine/arginine-rich splicing factor 12

Weight

30.3 kDa

Superfamily

splicing factor SR family

Alternative Names

35 kDa SR repressor protein; FLJ14459; serine/arginine-rich splicing factor 12; serine-arginine repressor protein (35 kDa); SFRS13B; SFRS19FLJ41221; Splicing factor, arginine/serine-rich 13BFLJ33484; Splicing factor, arginine/serine-rich 19; SR splicing factor 12; SRRP35; SRrp35RP11-63L7.3 SRSF12 SFRS13B, SFRS19, SRrp35 serine and arginine rich splicing factor 12 serine/arginine-rich splicing factor 12|35 kDa SR repressor protein|SR splicing factor 12|serine-arginine repressor protein (35 kDa)|splicing factor, arginine/serine-rich 13B|splicing factor, arginine/serine-rich 19

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SRSF12, check out the SRSF12 Infographic

SRSF12 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SRSF12: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8WXF0

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SRRP35 (SRSF12) (NM_080743) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SRRP35 (SRSF12) (NM_080743) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SRRP35 (SRSF12) (NM_080743) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8WXF0
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product