SPINT4 (NM_178455) Human Recombinant Protein

Spint4 protein,

Purified recombinant protein of Homo sapiens serine peptidase inhibitor, Kunitz type 4 (SPINT4)

Product Info Summary

SKU: PROTQ6UDR6
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SPINT4 (NM_178455) Human Recombinant Protein

View all Spint4 recombinant proteins

SKU/Catalog Number

PROTQ6UDR6

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens serine peptidase inhibitor, Kunitz type 4 (SPINT4)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SPINT4 (NM_178455) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ6UDR6)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

11.2 kDa

Amino Acid Sequence

MKSAKLGFLLRFFIFCSLNTLLLGGVNKIAEKICGDLKDPCKLDMNFGSCYEVHFRYFYNRTSKRCETFVFSGCNGNLNNFKLKIEREVACVAKYKPPR

Validation Images & Assay Conditions

Gene/Protein Information For SPINT4 (Source: Uniprot.org, NCBI)

Gene Name

SPINT4

Full Name

Kunitz-type protease inhibitor 4

Weight

11.2 kDa

Alternative Names

C20orf137; Chromosome 20 Open Reading Frame 137; DJ601O1.1; Kunitz-Type Protease Inhibitor 4; Serine Peptidase Inhibitor, Kunitz Type 4 ; Serine Protease Inhibitor, Kunitz Type 4; SPINT3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SPINT4, check out the SPINT4 Infographic

SPINT4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SPINT4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ6UDR6

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SPINT4 (NM_178455) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SPINT4 (NM_178455) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SPINT4 (NM_178455) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ6UDR6
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.