SOX14 (NM_004189) Human Recombinant Protein

SOX14 protein,

Recombinant protein of human SRY (sex determining region Y)-box 14 (SOX14)

Product Info Summary

SKU: PROTO95416
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SOX14 (NM_004189) Human Recombinant Protein

View all SOX14 recombinant proteins

SKU/Catalog Number

PROTO95416

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human SRY (sex determining region Y)-box 14 (SOX14)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SOX14 (NM_004189) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO95416)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

26.3 kDa

Amino Acid Sequence

MSKPSDHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDEAKRLRAQHMKEHPDYKYRPRRKPKNLLKKDRYVFPLPYLGDTDPLKAAGLPVGASDGLLSAPEKARAFLPPASAPYSLLDPAQFSSSAIQKMGEVPHTLATGALPYASTLGYQNGAFGSLSCPSQHTHTHPSPTNPGYVVPCNCTAWSASTLQPPVAYILFPGMTKTGIDPYSSAHATAM

Validation Images & Assay Conditions

Gene/Protein Information For SOX14 (Source: Uniprot.org, NCBI)

Gene Name

SOX14

Full Name

Transcription factor SOX-14

Weight

26.3 kDa

Alternative Names

Transcription factor SOX-14 SOX14 SOX28 SRY-box transcription factor 14 transcription factor SOX-14|HMG box transcription factor SOX-14|SRY (sex determining region Y)-box 14|SRY-box 14

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SOX14, check out the SOX14 Infographic

SOX14 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SOX14: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO95416

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SOX14 (NM_004189) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SOX14 (NM_004189) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SOX14 (NM_004189) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO95416
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.