SNX32 (NM_152760) Human Recombinant Protein

Sorting Nexin 32 protein,

Recombinant protein of human sorting nexin 32 (SNX32)

Product Info Summary

SKU: PROTQ86XE0
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SNX32 (NM_152760) Human Recombinant Protein

View all Sorting Nexin 32 recombinant proteins

SKU/Catalog Number

PROTQ86XE0

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human sorting nexin 32 (SNX32)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SNX32 (NM_152760) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ86XE0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

46.2 kDa

Amino Acid Sequence

METYAEVGKEGKPSCASVDLQGDSSLQVEISDAVSERDKVKFTVQTKSCLPHFAQTEFSVVRQHEEFIWLHDAYVENEEYAGLIIPPAPPRPDFEASREKLQKLGEGDSSVTREEFAKMKQELEAEYLAIFKKTVAMHEVFLQRLAAHPTLRRDNNFFVFLEYGQDLSVRGKNRKELLGGFLRNIVKSADEALITGMSGLKEVDDFFEHERTFLLEYHTRIRDACLRADRVMRAHKCLADDYIPISAALSSLGTQEVNQLRTSFLKLAELFERLRKLEGRVVSDEDLKLSDMLRYYMRDSQAAKDLLYRRLRALADYENANKALDKARTRNREVRPAESHQQLCCQRFERLSDYAKQELMDFKSRRVSSFRKNLIELAELELKHAKASTLILRNTLVALKGEP

Validation Images & Assay Conditions

Gene/Protein Information For SNX32 (Source: Uniprot.org, NCBI)

Gene Name

SNX32

Full Name

Sorting nexin-32

Weight

46.2 kDa

Superfamily

sorting nexin family

Alternative Names

DKFZp761P1320; FLJ30934; MGC42112; MGC57276; SNX6B; sorting nexin 32; sorting nexin 6B; sorting nexin-32; Sorting nexin-6B

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SNX32, check out the SNX32 Infographic

SNX32 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SNX32: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used SNX32 (NM_152760) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SNX32 (NM_152760) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SNX32 (NM_152760) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ86XE0
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.