SNX16 (NM_152836) Human Recombinant Protein

Snx16 protein,

Recombinant protein of human sorting nexin 16 (SNX16), transcript variant 2

Product Info Summary

SKU: PROTP57768
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SNX16 (NM_152836) Human Recombinant Protein

View all Snx16 recombinant proteins

SKU/Catalog Number

PROTP57768

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human sorting nexin 16 (SNX16), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SNX16 (NM_152836) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP57768)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

39 kDa

Amino Acid Sequence

MATPYVPVPMPIGNSASSFTTNRNQRSSSFGSVSTSSNSSKGQLEDSNMGNFKQTSVPDQMDNTSSVCSSPLIRTKFTGTASSIEYSTRPRDTEEQNPETVNWEDRPSTPTILGYEVMEERAKFTVYKILVKKTPEESWVVFRRYTDFSRLNDKLKEMFPGFRLALPPKRWFKDNYNADFLEDRQLGLQAFLQNLVAHKDIANCLAVREFLCLDDPPGPFDSLEESRAFCETLEETNYRLQKELLEKQKEMESLKKLLSEKQLHIDTLENRIRTLSLEPEESLDVSETEGEQILKVESSALEVDQDVLDEESRADNKPCLSFSEPENAVSEIEVAEVAYDAEED

Validation Images & Assay Conditions

Gene/Protein Information For SNX16 (Source: Uniprot.org, NCBI)

Gene Name

SNX16

Full Name

Sorting nexin-16

Weight

39 kDa

Superfamily

sorting nexin family

Alternative Names

DKFZp666H147; sorting nexin 16; sorting nexin-16 Snx16|sorting nexin 16|sorting nexin-16

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SNX16, check out the SNX16 Infographic

SNX16 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SNX16: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP57768

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SNX16 (NM_152836) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SNX16 (NM_152836) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SNX16 (NM_152836) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP57768
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product