SNX12 (NM_013346) Human Recombinant Protein

SNX12 protein,

Recombinant protein of human sorting nexin 12 (SNX12)

Product Info Summary

SKU: PROTQ9UMY4
Size: 20 µg
Source: HEK293T

Product Name

SNX12 (NM_013346) Human Recombinant Protein

View all SNX12 recombinant proteins

SKU/Catalog Number

PROTQ9UMY4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human sorting nexin 12 (SNX12)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SNX12 (NM_013346) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UMY4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

18.7 kDa

Amino Acid Sequence

MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKVRQ

Validation Images & Assay Conditions

Gene/Protein Information For SNX12 (Source: Uniprot.org, NCBI)

Gene Name

SNX12

Full Name

Sorting nexin-12

Weight

18.7 kDa

Superfamily

sorting nexin family

Alternative Names

B-cell CLL/lymphoma 7 protein family member C; B-cell CLL/lymphoma 7C SNX12 sorting nexin 12 sorting nexin-12

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SNX12, check out the SNX12 Infographic

SNX12 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SNX12: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UMY4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SNX12 (NM_013346) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SNX12 (NM_013346) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SNX12 (NM_013346) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UMY4
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.