SNTN (NM_001080537) Human Recombinant Protein

Sentan protein,

Product Info Summary

SKU: PROTA6NMZ2
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SNTN (NM_001080537) Human Recombinant Protein

View all Sentan recombinant proteins

SKU/Catalog Number

PROTA6NMZ2

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human sentan, cilia apical structure protein (SNTN)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SNTN (NM_001080537) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTA6NMZ2)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

16.3 kDa

Amino Acid Sequence

MGGCMHSTQDKSLHLEGDPNPSAAPTSTCAPRKMPKRISISKQLASVKALRKCSDLEKAIATTALIFRNSSDSDGKLEKAIAKDLLQTQFRNFAEGQETKPKYREILSELDEHTENKLDFEDFMILLLSITVMSDLLQNIRNVKIMK

Validation Images & Assay Conditions

Gene/Protein Information For SNTN (Source: Uniprot.org, NCBI)

Gene Name

SNTN

Full Name

Sentan

Weight

16.3 kDa

Superfamily

S-100 family

Alternative Names

FLJ44379; S100A1L; sentan; sentan, cilia apical structure protein SNTN S100A1L, S100AL, sentan sentan, cilia apical structure protein sentan|S100A-like protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SNTN, check out the SNTN Infographic

SNTN infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SNTN: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTA6NMZ2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SNTN (NM_001080537) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SNTN (NM_001080537) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SNTN (NM_001080537) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTA6NMZ2
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product