SMAGP (NM_001033873) Human Recombinant Protein

SMAGP protein,

Recombinant protein of human small trans-membrane and glycosylated protein (LOC57228), transcript variant 2

Product Info Summary

SKU: PROTQ0VAQ4
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SMAGP (NM_001033873) Human Recombinant Protein

View all SMAGP recombinant proteins

SKU/Catalog Number

PROTQ0VAQ4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human small trans-membrane and glycosylated protein (LOC57228), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SMAGP (NM_001033873) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ0VAQ4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

10.5 kDa

Amino Acid Sequence

MTSLLTTPSPREELMTTPILQPTEALSPEDGASTALIAVVITVVFLTLLSVVILIFFYLYKNKGSYVTYEPTEGEPSAIVQMESDLAKGSEKEEYFI

Validation Images & Assay Conditions

Gene/Protein Information For SMAGP (Source: Uniprot.org, NCBI)

Gene Name

SMAGP

Full Name

Small cell adhesion glycoprotein

Weight

10.5 kDa

Superfamily

SMAGP family

Alternative Names

hSMAGP; LOC57228; MGC149453; MGC149454; SMAGP; small cell adhesion glycoprotein; small cell transmembrane and glycosylated protein; Small transmembrane and glycosylated protein; small trans-membrane and glycosylated protein SMAGP hSMAGP small cell adhesion glycoprotein small cell adhesion glycoprotein|small cell transmembrane and glycosylated protein|small trans-membrane and glycosylated protein|small transmembrane and glycosylated protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SMAGP, check out the SMAGP Infographic

SMAGP infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SMAGP: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ0VAQ4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SMAGP (NM_001033873) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SMAGP (NM_001033873) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SMAGP (NM_001033873) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ0VAQ4
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.