SERPINB8 (NM_001031848) Human Recombinant Protein

Serpin B8/Proteinase Inhibitor 8 protein,

Product Info Summary

SKU: PROTP50452
Size: 20 µg
Source: HEK293T

Product Name

SERPINB8 (NM_001031848) Human Recombinant Protein

View all Serpin B8/Proteinase Inhibitor 8 recombinant proteins

SKU/Catalog Number

PROTP50452

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 8 (SERPINB8), transcript variant 3

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SERPINB8 (NM_001031848) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP50452)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

27.5 kDa

Amino Acid Sequence

MDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKDGDIHRGFQSLLSEVNRTGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWVAEKTEGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKEAKFKMGYADEVHTQVLELPYVEEELSMVILLPDDNTDLAVKE

Validation Images & Assay Conditions

Gene/Protein Information For SERPINB8 (Source: Uniprot.org, NCBI)

Gene Name

SERPINB8

Full Name

Serpin B8

Weight

27.5 kDa

Superfamily

serpin family

Alternative Names

CAP2; CAP-2; CAP2clade B (ovalbumin), member 8; Cytoplasmic antiproteinase 2; NK10; Peptidase inhibitor 8; PI8; PI-8; protease inhibitor 8 (ovalbumin type); Serpin B8; serpin peptidase inhibitor, clade B (ovalbumin), member 8 SERPINB8 C18orf53, CAP2, PI-8, PI8, PSS5 serpin family B member 8 serpin B8|cytoplasmic antiproteinase 2|peptidase inhibitor 8|protease inhibitor 8 (ovalbumin type)|serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 8|serpin peptidase inhibitor, clade B (ovalbumin), member 8

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SERPINB8, check out the SERPINB8 Infographic

SERPINB8 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SERPINB8: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP50452

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SERPINB8 (NM_001031848) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SERPINB8 (NM_001031848) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SERPINB8 (NM_001031848) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP50452
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.