Product Info Summary
SKU: | PROTQ99611 |
---|---|
Size: | 20 µg |
Source: | HEK293T |
Customers Who Bought This Also Bought
Product info
Product Name
Selenophosphate synthetase 2 (SEPHS2) (NM_012248) Human Recombinant Protein
View all Sephs2 recombinant proteins
SKU/Catalog Number
PROTQ99611
Size
20 µg
Description
Purified recombinant protein of Homo sapiens selenophosphate synthetase 2 (SEPHS2)
Storage & Handling
Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)
Cite This Product
Selenophosphate synthetase 2 (SEPHS2) (NM_012248) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ99611)
Form
Frozen Solution in PBS Buffer
Formulation
25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Concentration
>50 ug/mL as determined by microplate BCA method
Purity
> 80% as determined by SDS-PAGE and Coomassie blue staining
Predicted MW
47.1 kDa
Amino Acid Sequence
MAEASATGACGEAMAAAEGSSGPAGLTLGRSFSNYRPFEPQALGLSPSWRLTGFSGMKG*GCKVPQEALLKLLAGLTRPDVRPPLGRGLVGGQEEASQEAGLPAGAGPSPTFPALGIGMDSCVIPLRHGGLSLVQTTDFFYPLVEDPYMMGRIACANVLSDLYAMGITECDNMLMLLSVSQSMSEEEREKVTPLMVKGFRDAAEEGGTAVTGGQTVVNPWIIIGGVATVVCQPNEFIMPDSAVVGDVLVLTKPLGTQVAVNAHQWLDNPERWNKVKMVVSREEVELAYQEAMFNMATLNRTAAGLMHTFNAHAATDITGFGILGHSQNLAKQQRNEVSFVIHNLPIIAKMAAVSKASGRFGLLQGTSAETSGGLLICLPREQAARFCSEIKSSKYGEGHQAWIVGIVEKGNRTARIIDKPRVIEVLPRGATAAVLAPDSSNASSEPSSAssay dilution & Images
Validation Images & Assay Conditions
![protq99611 sephs2 human recombinant protein protq99611 sephs2 human recombinant protein](https://www.bosterbio.com/media/catalog/product/p/r/protq99611-sephs2-human-recombinant-protein.jpg)
Click image to see more details
Coomassie blue staining of purified SEPHS2 protein. The protein was produced from HEK293T cells transfected with SEPHS2 cDNA clone.
Protein Target Info & Infographic
Gene/Protein Information For Sephs2 (Source: Uniprot.org, NCBI)
Gene Name
Sephs2
Full Name
Selenide, water dikinase 2
Weight
47.1 kDa
Superfamily
selenophosphate synthase 1 family
Alternative Names
EC 2.7.9.3; Selenophosphate synthase 2; selenophosphate synthetase 2; SPS2water dikinase 2 Sephs2|S, Sps2, Ysg, Ysg3|selenophosphate synthetase 2|selenide, water dikinase 2|selenium donor protein 2|selenophosphate synthase 2|the SelD gene product
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on Sephs2, check out the Sephs2 Infographic
![Sephs2 infographic](/media/images/gene-infographic-example.jpg)
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for Sephs2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Selenophosphate synthetase 2 (SEPHS2) (NM_012248) Human Recombinant Protein (PROTQ99611)
Hello CJ!
No publications found for PROTQ99611
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Selenophosphate synthetase 2 (SEPHS2) (NM_012248) Human Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Selenophosphate synthetase 2 (SEPHS2) (NM_012248) Human Recombinant Protein
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question