Selenophosphate synthetase 2 (SEPHS2) (NM_012248) Human Recombinant Protein

Sephs2 protein,

Purified recombinant protein of Homo sapiens selenophosphate synthetase 2 (SEPHS2)

Product Info Summary

SKU: PROTQ99611
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Selenophosphate synthetase 2 (SEPHS2) (NM_012248) Human Recombinant Protein

View all Sephs2 recombinant proteins

SKU/Catalog Number

PROTQ99611

Size

20 µg

Description

Purified recombinant protein of Homo sapiens selenophosphate synthetase 2 (SEPHS2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Selenophosphate synthetase 2 (SEPHS2) (NM_012248) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ99611)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

47.1 kDa

Amino Acid Sequence

MAEASATGACGEAMAAAEGSSGPAGLTLGRSFSNYRPFEPQALGLSPSWRLTGFSGMKG*GCKVPQEALLKLLAGLTRPDVRPPLGRGLVGGQEEASQEAGLPAGAGPSPTFPALGIGMDSCVIPLRHGGLSLVQTTDFFYPLVEDPYMMGRIACANVLSDLYAMGITECDNMLMLLSVSQSMSEEEREKVTPLMVKGFRDAAEEGGTAVTGGQTVVNPWIIIGGVATVVCQPNEFIMPDSAVVGDVLVLTKPLGTQVAVNAHQWLDNPERWNKVKMVVSREEVELAYQEAMFNMATLNRTAAGLMHTFNAHAATDITGFGILGHSQNLAKQQRNEVSFVIHNLPIIAKMAAVSKASGRFGLLQGTSAETSGGLLICLPREQAARFCSEIKSSKYGEGHQAWIVGIVEKGNRTARIIDKPRVIEVLPRGATAAVLAPDSSNASSEPSS

Validation Images & Assay Conditions

Gene/Protein Information For Sephs2 (Source: Uniprot.org, NCBI)

Gene Name

Sephs2

Full Name

Selenide, water dikinase 2

Weight

47.1 kDa

Superfamily

selenophosphate synthase 1 family

Alternative Names

EC 2.7.9.3; Selenophosphate synthase 2; selenophosphate synthetase 2; SPS2water dikinase 2 Sephs2|S, Sps2, Ysg, Ysg3|selenophosphate synthetase 2|selenide, water dikinase 2|selenium donor protein 2|selenophosphate synthase 2|the SelD gene product

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Sephs2, check out the Sephs2 Infographic

Sephs2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Sephs2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ99611

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Selenophosphate synthetase 2 (SEPHS2) (NM_012248) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Selenophosphate synthetase 2 (SEPHS2) (NM_012248) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Selenophosphate synthetase 2 (SEPHS2) (NM_012248) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ99611
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.