Click image to see more details
Product Info Summary
| SKU: | PROTQ99611 |
|---|---|
| Size: | 20 µg |
| Source: | HEK293T |
Customers Who Bought This Also Bought
Product info
Product Name
Selenophosphate synthetase 2 (SEPHS2) (NM_012248) Human Recombinant Protein
View all Sephs2 recombinant proteins
SKU/Catalog Number
PROTQ99611
Size
20 µg
Description
Purified recombinant protein of Homo sapiens selenophosphate synthetase 2 (SEPHS2)
Storage & Handling
Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)
Cite This Product
Selenophosphate synthetase 2 (SEPHS2) (NM_012248) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ99611)
Form
Frozen Solution in PBS Buffer
Formulation
25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Concentration
>50 ug/mL as determined by microplate BCA method
Purity
> 80% as determined by SDS-PAGE and Coomassie blue staining
Predicted MW
47.1 kDa
Amino Acid Sequence
MAEASATGACGEAMAAAEGSSGPAGLTLGRSFSNYRPFEPQALGLSPSWRLTGFSGMKG*GCKVPQEALLKLLAGLTRPDVRPPLGRGLVGGQEEASQEAGLPAGAGPSPTFPALGIGMDSCVIPLRHGGLSLVQTTDFFYPLVEDPYMMGRIACANVLSDLYAMGITECDNMLMLLSVSQSMSEEEREKVTPLMVKGFRDAAEEGGTAVTGGQTVVNPWIIIGGVATVVCQPNEFIMPDSAVVGDVLVLTKPLGTQVAVNAHQWLDNPERWNKVKMVVSREEVELAYQEAMFNMATLNRTAAGLMHTFNAHAATDITGFGILGHSQNLAKQQRNEVSFVIHNLPIIAKMAAVSKASGRFGLLQGTSAETSGGLLICLPREQAARFCSEIKSSKYGEGHQAWIVGIVEKGNRTARIIDKPRVIEVLPRGATAAVLAPDSSNASSEPSSAssay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
Coomassie blue staining of purified SEPHS2 protein. The protein was produced from HEK293T cells transfected with SEPHS2 cDNA clone.
Protein Target Info & Infographic
Gene/Protein Information For SEPHS2 (Source: Uniprot.org, NCBI)
Gene Name
SEPHS2
Full Name
Selenide, water dikinase 2
Weight
47.1 kDa
Superfamily
selenophosphate synthase 1 family
Alternative Names
EC 2.7.9.3; Selenophosphate synthase 2; selenophosphate synthetase 2; SPS2water dikinase 2 Sephs2|S, Sps2, Ysg, Ysg3|selenophosphate synthetase 2|selenide, water dikinase 2|selenium donor protein 2|selenophosphate synthase 2|the SelD gene product
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on SEPHS2, check out the SEPHS2 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for SEPHS2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Selenophosphate synthetase 2 (SEPHS2) (NM_012248) Human Recombinant Protein (PROTQ99611)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Selenophosphate synthetase 2 (SEPHS2) (NM_012248) Human Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Selenophosphate synthetase 2 (SEPHS2) (NM_012248) Human Recombinant Protein
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
