SCGB1C2 (NM_001097610) Human Recombinant Protein

SCGB1C2 protein,

Recombinant protein of human secretoglobin, family 1C, member 1-like (LOC653486)

Product Info Summary

SKU: PROTP0DMR2
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SCGB1C2 (NM_001097610) Human Recombinant Protein

View all SCGB1C2 recombinant proteins

SKU/Catalog Number

PROTP0DMR2

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human secretoglobin, family 1C, member 1-like (LOC653486)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SCGB1C2 (NM_001097610) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP0DMR2)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

10.3 kDa

Amino Acid Sequence

MKGSRALLLVALTLFCICRMATGEDNDEFFMDFLQTLLVGTPEELYEGTLGKYNVNEDAKAAMTELKSCRDGLQPMHKAELVKLLVQVLGSQDGA

Validation Images & Assay Conditions

Gene/Protein Information For SCGB1C2 (Source: Uniprot.org, NCBI)

Gene Name

SCGB1C2

Full Name

Secretoglobin family 1C member 2

Weight

10.3 kDa

Superfamily

secretoglobin family

Alternative Names

Secretoglobin family 1C member 2 SCGB1C2 SCGB1C1 secretoglobin family 1C member 2 secretoglobin family 1C member 2|Secretoglobin RYD5|Secretoglobin family 1C member 1|secretoglobin, family 1C, member 1-like

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SCGB1C2, check out the SCGB1C2 Infographic

SCGB1C2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SCGB1C2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used SCGB1C2 (NM_001097610) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SCGB1C2 (NM_001097610) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SCGB1C2 (NM_001097610) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP0DMR2
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.