RWDD1 (NM_001007464) Human Recombinant Protein

RWDD1 protein,

Product Info Summary

SKU: PROTQ9H446
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

RWDD1 (NM_001007464) Human Recombinant Protein

View all RWDD1 recombinant proteins

SKU/Catalog Number

PROTQ9H446

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human RWD domain containing 1 (RWDD1), transcript variant 3

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RWDD1 (NM_001007464) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9H446)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

16.9 kDa

Amino Acid Sequence

MTDYGEEQRNELEALESIYPDSFTVLSENPPSFTITVTSEAGENDETVQTTLKFTYSEKYPDEAPLYEIFSQENLEDNDVSDILKLLALQAEENLGMVMIFTLVTAVQEKLNEIVDQIKTRREEEKKQKEKEAEEAEKQLFHGTPVTIENFLNWKAKFDAELLEIKKKRMKEEEQAGKNKLSGKQLFETDHNLDTSDIQFLEDAGNNVEVDESLFQEMDDLELEDDEDDPDYNPADPESDSAD

Validation Images & Assay Conditions

Gene/Protein Information For RWDD1 (Source: Uniprot.org, NCBI)

Gene Name

RWDD1

Full Name

RWD domain-containing protein 1

Weight

16.9 kDa

Superfamily

RWDD1/GIR2 family

Alternative Names

DFRP2; DRG family-regulatory protein 2; PTD013; RWD domain containing 1; RWD domain-containing protein 1 RWDD1 CGI-24, PTD013 RWD domain containing 1 RWD domain-containing protein 1|DRG family-regulatory protein 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RWDD1, check out the RWDD1 Infographic

RWDD1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RWDD1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9H446

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RWDD1 (NM_001007464) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RWDD1 (NM_001007464) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RWDD1 (NM_001007464) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9H446
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

Loading publications

No publications found

No publications have been found for this product

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None