RTL10 (NM_024627) Human Recombinant Protein

RTL10 protein,

Recombinant protein of human chromosome 22 open reading frame 29 (C22orf29)

Product Info Summary

SKU: PROTQ7L3V2
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

RTL10 (NM_024627) Human Recombinant Protein

View all RTL10 recombinant proteins

SKU/Catalog Number

PROTQ7L3V2

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 22 open reading frame 29 (C22orf29)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RTL10 (NM_024627) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ7L3V2)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

39.1 kDa

Amino Acid Sequence

MPRGRCRQQGPRIPIWAAANYANAHPWQQMDKASPGVAYTPLVDPWIERPCCGDTVCVRTTMEQKSTASGTCGGKPAERGPLAGHMPSSRPHRVDFCWVPGSDPGTFDGSPWLLDRFLAQLGDYMSFHFEHYQDNISRVCEILRRLTGRAQAWAAPYLDGDLPLPDDYELFCQDLKEVVQDPNSFAEYHAVVTCPLPLASSQLPVAPQLPVVRQYLARFLEGLALDMGTAPRSLPAAMATPAVSGSNSVSRSALFEQQLTKESTPGPKEPPVLPSSTCSSKPGPVEPASSQPEEAAPTPVPRLSESANPPAQRPDPAHPGGPKPQKTEEEVLETEGDQEVSLGTPQEVVEAPETPGEPPLSPGF

Validation Images & Assay Conditions

Gene/Protein Information For RTL10 (Source: Uniprot.org, NCBI)

Gene Name

RTL10

Full Name

Protein Bop

Weight

39.1 kDa

Alternative Names

Protein Bop RTL10 BOP, C22orf29 retrotransposon Gag like 10 protein Bop|BH3-only protein|retrotransposon Gag-like protein 10

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RTL10, check out the RTL10 Infographic

RTL10 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RTL10: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used RTL10 (NM_024627) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RTL10 (NM_024627) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RTL10 (NM_024627) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ7L3V2
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.