RPS27L (NM_015920) Human Recombinant Protein

RPS27L protein,

Recombinant protein of human ribosomal protein S27-like (RPS27L)

Product Info Summary

SKU: PROTQ71UM5
Size: 20 µg
Source: HEK293T

Product Name

RPS27L (NM_015920) Human Recombinant Protein

View all RPS27L recombinant proteins

SKU/Catalog Number

PROTQ71UM5

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ribosomal protein S27-like (RPS27L)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RPS27L (NM_015920) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ71UM5)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

9.3 kDa

Amino Acid Sequence

MPLARDLLHPSLEEEKKKHKEKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH

Validation Images & Assay Conditions

Gene/Protein Information For RPS27L (Source: Uniprot.org, NCBI)

Gene Name

RPS27L

Full Name

40S ribosomal protein S27-like

Weight

9.3 kDa

Superfamily

eukaryotic ribosomal protein eS27 family

Alternative Names

40S ribosomal protein S27-like RPS27L ribosomal protein S27 like 40S ribosomal protein S27-like|small ribosomal subunit protein eS27-like

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RPS27L, check out the RPS27L Infographic

RPS27L infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RPS27L: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ71UM5

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RPS27L (NM_015920) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RPS27L (NM_015920) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RPS27L (NM_015920) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ71UM5
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product