RPRM (NM_019845) Human Recombinant Protein

RPRM protein,

Recombinant protein of human reprimo, TP53 dependent G2 arrest mediator candidate (RPRM)

Product Info Summary

SKU: PROTQ9NS64
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

RPRM (NM_019845) Human Recombinant Protein

View all RPRM recombinant proteins

SKU/Catalog Number

PROTQ9NS64

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human reprimo, TP53 dependent G2 arrest mediator candidate (RPRM)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RPRM (NM_019845) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NS64)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

11.6 kDa

Amino Acid Sequence

MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIAVMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY

Validation Images & Assay Conditions

Gene/Protein Information For RPRM (Source: Uniprot.org, NCBI)

Gene Name

RPRM

Full Name

Protein reprimo

Weight

11.6 kDa

Superfamily

reprimo family

Alternative Names

Protein reprimo RPRM REPRIMO reprimo, TP53 dependent G2 arrest mediator homolog protein reprimo|candidate mediator of the p53 dependent G2 arrest|reprimo, TP53 dependant G2 arrest mediator candidate|reprimo, TP53 dependent G2 arrest mediator candidate

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RPRM, check out the RPRM Infographic

RPRM infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RPRM: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NS64

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RPRM (NM_019845) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RPRM (NM_019845) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RPRM (NM_019845) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NS64
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.