RPP20 (POP7) (NM_005837) Human Recombinant Protein

POP7 protein,

Product Info Summary

SKU: PROTO75817
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

RPP20 (POP7) (NM_005837) Human Recombinant Protein

View all POP7 recombinant proteins

SKU/Catalog Number

PROTO75817

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human processing of precursor 7, ribonuclease P/MRP subunit (S. cerevisiae) (POP7)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RPP20 (POP7) (NM_005837) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO75817)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

15.5 kDa

Amino Acid Sequence

MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK

Validation Images & Assay Conditions

Gene/Protein Information For POP7 (Source: Uniprot.org, NCBI)

Gene Name

POP7

Full Name

Ribonuclease P protein subunit p20

Weight

15.5 kDa

Superfamily

histone-like Alba family

Alternative Names

0610037N12Rik; EC 3.1.26.5; hPOP7; processing of precursor 7, ribonuclease P subunit (S. cerevisiae); processing of precursor 7, ribonuclease P subunit; processing of precursor 7, ribonuclease P/MRP subunit (S. cerevisiae); ribonuclease P protein subunit p20; Ribonucleases P/MRP protein subunit POP7 homolog; RNaseP protein p20; RPP20S. cerevisiae) homolog POP7 0610037N12Rik, RPP2, RPP20 POP7 homolog, ribonuclease P/MRP subunit ribonuclease P protein subunit p20|POP7 (processing of precursor, S. cerevisiae) homolog|RNaseP protein p20|hPOP7|processing of precursor 7, ribonuclease P subunit|processing of precursor 7, ribonuclease P/MRP subunit|ribonucleases P/MRP protein subunit POP7 homolog

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on POP7, check out the POP7 Infographic

POP7 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for POP7: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO75817

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RPP20 (POP7) (NM_005837) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RPP20 (POP7) (NM_005837) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RPP20 (POP7) (NM_005837) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO75817
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.