RPL26L1 (NM_016093) Human Recombinant Protein

RPL26L1 protein,

Product Info Summary

SKU: PROTQ9UNX3
Size: 20 µg
Source: HEK293T

Product Name

RPL26L1 (NM_016093) Human Recombinant Protein

View all RPL26L1 recombinant proteins

SKU/Catalog Number

PROTQ9UNX3

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ribosomal protein L26-like 1 (RPL26L1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RPL26L1 (NM_016093) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UNX3)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

17.1 kDa

Amino Acid Sequence

MKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEELIEKMQE

Validation Images & Assay Conditions

Gene/Protein Information For RPL26L1 (Source: Uniprot.org, NCBI)

Gene Name

RPL26L1

Full Name

60S ribosomal protein L26-like 1

Weight

17.1 kDa

Superfamily

universal ribosomal protein uL24 family

Alternative Names

60S ribosomal protein L26-like 1 RPL26L1 RPL26P1 ribosomal protein L26 like 1 60S ribosomal protein L26-like 1|large ribosomal subunit protein uL24-like 1|ribosomal protein L26 homolog|ribosomal protein L26 pseudogene 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RPL26L1, check out the RPL26L1 Infographic

RPL26L1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RPL26L1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UNX3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RPL26L1 (NM_016093) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RPL26L1 (NM_016093) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RPL26L1 (NM_016093) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UNX3
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.