RALB (NM_002881) Human Recombinant Protein

RALB protein,

Product Info Summary

SKU: PROTP11234
Size: 20 µg
Source: HEK293T

Product Name

RALB (NM_002881) Human Recombinant Protein

View all RALB recombinant proteins

SKU/Catalog Number

PROTP11234

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) (RALB)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RALB (NM_002881) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP11234)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

23.2 kDa

Amino Acid Sequence

MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL

Validation Images & Assay Conditions

Gene/Protein Information For RALB (Source: Uniprot.org, NCBI)

Gene Name

RALB

Full Name

Ras-related protein Ral-B

Weight

23.2 kDa

Superfamily

small GTPase superfamily

Alternative Names

GTP binding protein; RalB; RAS-like protein B; ras-related protein Ral-B; v-ral simian leukemia viral oncogene homolog B (ras related; GTP bindingprotein) RALB RAS like proto-oncogene B ras-related protein Ral-B|RALB Ras like proto-oncogene B|RAS-like protein B|ras related GTP binding protein B|v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RALB, check out the RALB Infographic

RALB infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RALB: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP11234

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RALB (NM_002881) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RALB (NM_002881) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RALB (NM_002881) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP11234
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.