RABL5 (IFT22) (NM_022777) Human Recombinant Protein

IFT22 protein,

Product Info Summary

SKU: PROTQ9H7X7
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

RABL5 (IFT22) (NM_022777) Human Recombinant Protein

View all IFT22 recombinant proteins

SKU/Catalog Number

PROTQ9H7X7

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human RAB, member RAS oncogene family-like 5 (RABL5), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RABL5 (IFT22) (NM_022777) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9H7X7)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

20.7 kDa

Amino Acid Sequence

MLKAKILFVGPCESGKTVLANFLTESSDITEYSPTQGVRILEFENPHVTSNNKGTGCEFELWDCGGDAKFESCWPALMKDAHGVVIVFNADIPSHRKEMEMWYSCFVQQPSLQDTQCMLIAHHKPGSGDDKGSLSLSPPLNKLKLVHSNLEDDPEEIRMEFIKYLKSIINSMSESRDREEMSIMT

Validation Images & Assay Conditions

Gene/Protein Information For IFT22 (Source: Uniprot.org, NCBI)

Gene Name

IFT22

Full Name

Intraflagellar transport protein 22 homolog

Weight

20.7 kDa

Superfamily

small GTPase superfamily

Alternative Names

Intraflagellar transport protein 22 homolog IFT22 FAP9, RABL5 intraflagellar transport 22 intraflagellar transport protein 22 homolog|RAB, member RAS oncogene family-like 5|RAB, member of RAS oncogene family-like 5|intraflagellar transport 22 homolog|rab-like protein 5

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on IFT22, check out the IFT22 Infographic

IFT22 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for IFT22: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9H7X7

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RABL5 (IFT22) (NM_022777) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RABL5 (IFT22) (NM_022777) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RABL5 (IFT22) (NM_022777) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9H7X7
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

Loading publications

No publications found

No publications have been found for this product

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None