PRR16 (NM_016644) Human Recombinant Protein

Proline rich 16 protein,

Recombinant protein of human proline rich 16 (PRR16)

Product Info Summary

SKU: PROTQ569H4
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PRR16 (NM_016644) Human Recombinant Protein

View all Proline rich 16 recombinant proteins

SKU/Catalog Number

PROTQ569H4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human proline rich 16 (PRR16)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PRR16 (NM_016644) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ569H4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

30.2 kDa

Amino Acid Sequence

MAQSGLTATSASQVQAILLPQPASVRHYAWVVDQIDTLTSDLQLEDEMTDSSKTDTLNSSSSGTTASSLEKIKVQANAPLIKPPAHPSAILTVLRKPNPPPPPPRLTPVKCEDPKRVVPTANPVKTNGTLLRNGGLPGGPNKIPNGDICCIPNSNLDKAPVQLLMHRPEKDRCPQAGPRERVRFNEKVQYHGYCPDCDTRYNIKNREVHLHSEPVHPPGKIPHQGPPLPPTPHLPPFPLENGGMGISHSNSFPPIRPATVPPPTAPKPQKTILRKSTTTTV

Validation Images & Assay Conditions

Gene/Protein Information For PRR16 (Source: Uniprot.org, NCBI)

Gene Name

PRR16

Full Name

Protein Largen

Weight

30.2 kDa

Alternative Names

DSC54; Mesenchymal stem cell protein DSC54; MGC104614; proline rich 16; proline-rich protein 16 PRR16 DSC54, LARGEN proline rich 16 protein Largen|mesenchymal stem cell protein DSC54|proline-rich protein 16

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PRR16, check out the PRR16 Infographic

PRR16 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PRR16: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ569H4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PRR16 (NM_016644) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PRR16 (NM_016644) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PRR16 (NM_016644) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ569H4
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product