PRR15L (NM_024320) Human Recombinant Protein

ATAD4 protein,

Recombinant protein of human ATPase family, AAA domain containing 4 (ATAD4)

Product Info Summary

SKU: PROTQ9BU68
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PRR15L (NM_024320) Human Recombinant Protein

View all ATAD4 recombinant proteins

SKU/Catalog Number

PROTQ9BU68

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ATPase family, AAA domain containing 4 (ATAD4)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PRR15L (NM_024320) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9BU68)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

11.5 kDa

Amino Acid Sequence

MTTEIGWWKLTFLRKKKSTPKVLYEIPDTYAQTEGDAEPPRPDAGGPNSDFNTRLEKIVDKSTKGKHVKVSNSGRFKEKKKVRATLAENPNLFDDHEEGRSSK

Validation Images & Assay Conditions

Gene/Protein Information For PRR15L (Source: Uniprot.org, NCBI)

Gene Name

PRR15L

Full Name

Proline-rich protein 15-like protein

Weight

11.5 kDa

Superfamily

PRR15 family

Alternative Names

ATAD4; ATPase family, AAA domain containing 4; MGC11242; proline rich 15-like; proline-rich protein 15-like protein; Protein ATAD4 PRR15L ATAD4 proline rich 15 like proline-rich protein 15-like protein|ATPase family, AAA domain containing 4|testicular tissue protein Li 157

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PRR15L, check out the PRR15L Infographic

PRR15L infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PRR15L: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9BU68

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PRR15L (NM_024320) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PRR15L (NM_024320) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PRR15L (NM_024320) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9BU68
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.